Lineage for d1op3m2 (1op3 M:116-228)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1290587Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1292198Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (6 species)
  7. 1292202Species Human (Homo sapiens) [TaxId:9606] [88575] (177 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
    Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) ! SQ NA # humanized antibody ! Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region ! SQ NA # engineered antibody
  8. 1292220Domain d1op3m2: 1op3 M:116-228 [87215]
    Other proteins in same PDB: d1op3h1, d1op3k1, d1op3k2, d1op3l1, d1op3l2, d1op3m1
    part of Fab 2G12
    complexed with bez, man

Details for d1op3m2

PDB Entry: 1op3 (more details), 1.75 Å

PDB Description: crystal structure of fab 2g12 bound to man1->2man
PDB Compounds: (M:) FAB 2G12, heavy chain

SCOPe Domain Sequences for d1op3m2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1op3m2 b.1.1.2 (M:116-228) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
tkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssgl
yslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk

SCOPe Domain Coordinates for d1op3m2:

Click to download the PDB-style file with coordinates for d1op3m2.
(The format of our PDB-style files is described here.)

Timeline for d1op3m2: