SCOP 1.71: Domain d1op3m1: 1op3 M:1-115

Lineage for d1op3m1 (1op3 M:1-115)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Engineered (including hybrid species) [88562] (52 PDB entries)

8. Domain d1op3m1: 1op3 M:1-115 [87214]
   Other proteins in same PDB: d1op3h2, d1op3k1, d1op3k2, d1op3l1, d1op3l2, d1op3m2
   part of engineered Fab 2G12
   complexed with box, man

Details for d1op3m1

PDB Entry: 1op3, 1.75 Å

PDB Description: crystal structure of fab 2g12 bound to man1->2man

SCOP Domain Sequences for d1op3m1:

Sequence; same for both SEQRES and ATOM records:

>d1op3m1 b.1.1.1 (M:1-115) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)}
evqlvesggglvkaggslilscgvsnfrisahtmnwvrrvpggglewvasistsstyrdy
adavkgrftvsrddledfvylqmhkmrvedtaiyycarkgsdrlsdndpfdawgpgtvvt
vspas

Timeline for d1op3m1:

• d1op3m1 first appeared in SCOP 1.65
  
• d1op3m1 appears in SCOP 1.69
  
• d1op3m1 appears in SCOP 1.73
  
• d1op3m1 last appears in SCOPe 2.07