Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species) |
Species Human (Homo sapiens) [TaxId:9606] [88569] (151 PDB entries) including humanized antibodies (chimeric proteins with human constant domains) SQ NA # humanized antibody ! Uniprot P01834 # KAC_HUMAN Ig kappa chain C region ! SQ P01834 # KAC_HUMAN Ig kappa chain C region. ! SQ NA # engineered antibody |
Domain d1op3l2: 1op3 L:108-212 [87213] Other proteins in same PDB: d1op3h1, d1op3h2, d1op3k1, d1op3l1, d1op3m1, d1op3m2 part of Fab 2G12 complexed with bez, man |
PDB Entry: 1op3 (more details), 1.75 Å
SCOPe Domain Sequences for d1op3l2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1op3l2 b.1.1.2 (L:108-212) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]} rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg
Timeline for d1op3l2: