SCOPe 2.04: Domain d1op3k2: 1op3 K:108-212

Lineage for d1op3k2 (1op3 K:108-212)

Root: SCOPe 2.04
Class b: All beta proteins [48724] (176 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)

Species Human (Homo sapiens) [TaxId:9606] [88569] (144 PDB entries)
including humanized antibodies (chimeric proteins with human constant domains)
SQ NA # humanized antibody ! Uniprot P01834 # KAC_HUMAN Ig kappa chain C region ! SQ P01834 # KAC_HUMAN Ig kappa chain C region. ! SQ NA # engineered antibody

Domain d1op3k2: 1op3 K:108-212 [87211]
Other proteins in same PDB: d1op3h1, d1op3h2, d1op3k1, d1op3l1, d1op3m1, d1op3m2
part of Fab 2G12
complexed with bez, man

Details for d1op3k2

PDB Entry: 1op3 (more details), 1.75 Å

PDB Description: crystal structure of fab 2g12 bound to man1->2man

PDB Compounds: (K:) FAB 2G12, light chain

SCOPe Domain Sequences for d1op3k2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1op3k2 b.1.1.2 (K:108-212) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

SCOPe Domain Coordinates for d1op3k2:

Click to download the PDB-style file with coordinates for d1op3k2.
(The format of our PDB-style files is described here.)

Timeline for d1op3k2: