SCOPe 2.01: Domain d1op3h2: 1op3 H:116-228

Lineage for d1op3h2 (1op3 H:116-228)

Root: SCOPe 2.01
Class b: All beta proteins [48724] (174 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (7 species)

Species Human (Homo sapiens) [TaxId:9606] [88575] (172 PDB entries)
including humanized antibodies (chimeric proteins with human constant domains)
Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) ! SQ NA # humanized antibody ! Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region ! SQ NA # engineered antibody

Domain d1op3h2: 1op3 H:116-228 [87209]
Other proteins in same PDB: d1op3h1, d1op3k1, d1op3k2, d1op3l1, d1op3l2, d1op3m1
part of Fab 2G12
complexed with bez, man

Details for d1op3h2

PDB Entry: 1op3 (more details), 1.75 Å

PDB Description: crystal structure of fab 2g12 bound to man1->2man

PDB Compounds: (H:) FAB 2G12, heavy chain

SCOPe Domain Sequences for d1op3h2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1op3h2 b.1.1.2 (H:116-228) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
tkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssgl
yslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk

SCOPe Domain Coordinates for d1op3h2:

Click to download the PDB-style file with coordinates for d1op3h2.
(The format of our PDB-style files is described here.)

Timeline for d1op3h2: