SCOPe 2.06: Domain d1oo0b_: 1oo0 B:

Lineage for d1oo0b_ (1oo0 B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families)

5. Family d.58.7.1: Canonical RBD [54929] (68 proteins)

6. Protein RNA-binding protein 8 [89938] (2 species)

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [89939] (3 PDB entries)
   CG8781 protein

8. Domain d1oo0b_: 1oo0 B: [87183]
   Other proteins in same PDB: d1oo0a_
   protein/RNA complex; complexed with bme, gol, mpd, sr

Details for d1oo0b_

PDB Entry: 1oo0, 1.85 Å

PDB Description: Crystal structure of the Drosophila Mago nashi-Y14 complex

PDB Compounds: (B:) cg8781-pa

SCOPe Domain Sequences for d1oo0b_:

Sequence; same for both SEQRES and ATOM records:

>d1oo0b_ d.58.7.1 (B:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
pgpqrsvegwilfvtsiheeaqedeiqekfcdygeiknihlnldrrtgfskgyalveyet
hkqalaakealngaeimgqtiqvdwcfvkgpk

Timeline for d1oo0b_:

• d1oo0b_ first appeared in SCOP 1.65
  
• d1oo0b_ appears in SCOPe 2.05
  
• d1oo0b_ appears in SCOPe 2.07
  
• d1oo0b_ appears in the current release, SCOPe 2.08