Class a: All alpha proteins [46456] (258 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (68 families) contains a small beta-sheet (wing) |
Family a.4.5.30: C-terminal domain of the rap74 subunit of TFIIF [63480] (1 protein) |
Protein C-terminal domain of the rap74 subunit of TFIIF [63481] (1 species) peptide-recognition motif |
Species Human (Homo sapiens) [TaxId:9606] [63482] (4 PDB entries) |
Domain d1onva_: 1onv A: [87171] complexed with Fcp1 C-terminal peptide, chain B |
PDB Entry: 1onv (more details)
SCOP Domain Sequences for d1onva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1onva_ a.4.5.30 (A:) C-terminal domain of the rap74 subunit of TFIIF {Human (Homo sapiens) [TaxId: 9606]} dvqvtedavrryltrkpmttkdllkkfqtkktglsseqtvnvlaqilkrlnperkmindk mhfslke
Timeline for d1onva_: