Lineage for d1onba_ (1onb A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2870435Family c.37.1.14: RNA helicase [52724] (7 proteins)
    duplication: consists of two similar domains, one binds NTP and the other binds RNA; also contains an all-alpha subdomain in the C-terminal extension
  6. 2870478Protein HCV helicase domain, N-terminal domain [418962] (1 species)
  7. 2870479Species Human hepatitis C virus (HCV), different isolates [TaxId:11103] [419424] (17 PDB entries)
  8. 2870510Domain d1onba_: 1onb A: [87137]
    an engineered arginine-rich subdomain 2

Details for d1onba_

PDB Entry: 1onb (more details)

PDB Description: solution structure of an engineered arginine-rich subdomain 2 of the hepatitis c virus ns3 rna helicase
PDB Compounds: (A:) Helicase NS3

SCOPe Domain Sequences for d1onba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1onba_ c.37.1.14 (A:) HCV helicase domain, N-terminal domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]}
gsvtvphpnieevalsttgeipfygkaiplevikggrhlifchskkkcdelaaklvalgi
navayyrgldvsviptngdvvvvatdalmtgftgdfdsvidcntsdgkpqdavsrtqrrg
rtgrgkpgiyrfvapger

SCOPe Domain Coordinates for d1onba_:

Click to download the PDB-style file with coordinates for d1onba_.
(The format of our PDB-style files is described here.)

Timeline for d1onba_: