Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) |
Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins) |
Protein Putative acetyltransferase YycN [90011] (1 species) |
Species Bacillus subtilis [TaxId:1423] [90012] (2 PDB entries) |
Domain d1on0b1: 1on0 B:2-156 [87096] Other proteins in same PDB: d1on0a2, d1on0b2, d1on0c2, d1on0d2 structural genomics; target SR144 complexed with cl, so4 |
PDB Entry: 1on0 (more details), 2.2 Å
SCOPe Domain Sequences for d1on0b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1on0b1 d.108.1.1 (B:2-156) Putative acetyltransferase YycN {Bacillus subtilis [TaxId: 1423]} timltpmqteefrsyltyttkhyaeekvkagtwlpedaqllskqvftdllprgletphhh lwslklnekdivgwlwihaepehpqqeafiydfglyepyrgkgyakqalaaldqaarsmg irklslhvfahnqtarklyeqtgfqetdvvmskkl
Timeline for d1on0b1: