Lineage for d1omwa3 (1omw A:186-549)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 334933Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 334934Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (6 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 334971Family d.144.1.7: Protein kinases, catalytic subunit [88854] (41 proteins)
    members organised in the groups and subfamiles specified by the comments
  6. 335174Protein G-protein coupled receptor kinase 2 [90034] (1 species)
    AGC group; GRKs subfamily; serine/threonine kinase
  7. 335175Species Cow (Bos taurus) [TaxId:9913] [90035] (1 PDB entry)
  8. 335176Domain d1omwa3: 1omw A:186-549 [87088]
    Other proteins in same PDB: d1omwa1, d1omwa2, d1omwb_, d1omwg_
    complexed with cmt; mutant

Details for d1omwa3

PDB Entry: 1omw (more details), 2.5 Å

PDB Description: Crystal Structure of the complex between G Protein-Coupled Receptor Kinase 2 and Heterotrimeric G Protein beta 1 and gamma 2 subunits

SCOP Domain Sequences for d1omwa3:

Sequence, based on SEQRES records: (download)

>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus)}
ltmndfsvhriigrggfgevygcrkadtgkmyamkcldkkrikmkqgetlalnerimlsl
vstgdcpfivcmsyafhtpdklsfildlmnggdlhyhlsqhgvfseadmrfyaaeiilgl
ehmhnrfvvyrdlkpanilldehghvrisdlglacdfskkkphasvgthgymapevlqkg
vaydssadwfslgcmlfkllrghspfrqhktkdkheidrmtltmavelpdsfspelrsll
egllqrdvnrrlgclgrgaqevkespffrsldwqmvflqkyppplipprgevnaadafdi
gsfdeedtkgiklldsdqelyrnfpltiserwqqevaetvfdtinaetdrlearkktknk
qlgh

Sequence, based on observed residues (ATOM records): (download)

>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus)}
ltmndfsvhriigrggfgevygcrkadtgkmyamkcldkkrikmkqgetlalnerimlsl
vstgdcpfivcmsyafhtpdklsfildlmnggdlhyhlsqhgvfseadmrfyaaeiilgl
ehmhnrfvvyrdlkpanilldehghvrisdlglacdfskkkphasvgthgymapevlqkg
vaydssadwfslgcmlfkllrghspfrqhktkdkheidrmtltmavelpdsfspelrsll
egllqrdvnrrlgclgrgaqevkespffrsldwqmvflqkyppplipprgiklldsdqel
yrnfpltiserwqqevaetvfdtinaetdrlearkktknkqlgh

SCOP Domain Coordinates for d1omwa3:

Click to download the PDB-style file with coordinates for d1omwa3.
(The format of our PDB-style files is described here.)

Timeline for d1omwa3: