Lineage for d1omwa2 (1omw A:550-668)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 805150Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 805151Superfamily b.55.1: PH domain-like [50729] (13 families) (S)
  5. 805152Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (47 proteins)
    Pfam PF00169
  6. 805239Protein G-protein coupled receptor kinase 2 (beta-adrenergic receptor kinase 1) [50747] (2 species)
  7. 805240Species Cow (Bos taurus) [TaxId:9913] [89354] (3 PDB entries)
  8. 805241Domain d1omwa2: 1omw A:550-668 [87087]
    Other proteins in same PDB: d1omwa1, d1omwa3, d1omwb_, d1omwg_
    complexed with cmt; mutant

Details for d1omwa2

PDB Entry: 1omw (more details), 2.5 Å

PDB Description: Crystal Structure of the complex between G Protein-Coupled Receptor Kinase 2 and Heterotrimeric G Protein beta 1 and gamma 2 subunits
PDB Compounds: (A:) g-protein coupled receptor kinase 2

SCOP Domain Sequences for d1omwa2:

Sequence, based on SEQRES records: (download)

>d1omwa2 b.55.1.1 (A:550-668) G-protein coupled receptor kinase 2 (beta-adrenergic receptor kinase 1) {Cow (Bos taurus) [TaxId: 9913]}
eedyalgkdcimhgymskmgnpfltqwqrryfylfpnrlewrgegeapqslltmeeiqsv
eetqikerkclllkirggkqfvlqcdsdpelvqwkkelrdayreaqqlvqrvpkmknkp

Sequence, based on observed residues (ATOM records): (download)

>d1omwa2 b.55.1.1 (A:550-668) G-protein coupled receptor kinase 2 (beta-adrenergic receptor kinase 1) {Cow (Bos taurus) [TaxId: 9913]}
eedyalgkdcimhgymskmgwqrryfylfpnrlewrgegeapqslltmeeiqsveetqik
erkclllkirggkqfvlqcdsdpelvqwkkelrdayreaqqlvqrvpkmknkp

SCOP Domain Coordinates for d1omwa2:

Click to download the PDB-style file with coordinates for d1omwa2.
(The format of our PDB-style files is described here.)

Timeline for d1omwa2: