Lineage for d1omwa2 (1omw A:550-668)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 467364Fold b.55: PH domain-like [50728] (1 superfamily)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 467365Superfamily b.55.1: PH domain-like [50729] (9 families) (S)
  5. 467366Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (24 proteins)
  6. 467405Protein G-protein coupled receptor kinase 2 (beta-adrenergic receptor kinase 1) [50747] (2 species)
  7. 467406Species Cow (Bos taurus) [TaxId:9913] [89354] (1 PDB entry)
  8. 467407Domain d1omwa2: 1omw A:550-668 [87087]
    Other proteins in same PDB: d1omwa1, d1omwa3, d1omwb_, d1omwg_

Details for d1omwa2

PDB Entry: 1omw (more details), 2.5 Å

PDB Description: Crystal Structure of the complex between G Protein-Coupled Receptor Kinase 2 and Heterotrimeric G Protein beta 1 and gamma 2 subunits

SCOP Domain Sequences for d1omwa2:

Sequence, based on SEQRES records: (download)

>d1omwa2 b.55.1.1 (A:550-668) G-protein coupled receptor kinase 2 (beta-adrenergic receptor kinase 1) {Cow (Bos taurus)}
eedyalgkdcimhgymskmgnpfltqwqrryfylfpnrlewrgegeapqslltmeeiqsv
eetqikerkclllkirggkqfvlqcdsdpelvqwkkelrdayreaqqlvqrvpkmknkp

Sequence, based on observed residues (ATOM records): (download)

>d1omwa2 b.55.1.1 (A:550-668) G-protein coupled receptor kinase 2 (beta-adrenergic receptor kinase 1) {Cow (Bos taurus)}
eedyalgkdcimhgymskmgwqrryfylfpnrlewrgegeapqslltmeeiqsveetqik
erkclllkirggkqfvlqcdsdpelvqwkkelrdayreaqqlvqrvpkmknkp

SCOP Domain Coordinates for d1omwa2:

Click to download the PDB-style file with coordinates for d1omwa2.
(The format of our PDB-style files is described here.)

Timeline for d1omwa2: