Lineage for d1om7a2 (1om7 A:3-244)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2204982Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2204983Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2205315Family d.92.1.6: Serralysin-like metalloprotease, catalytic (N-terminal) domain [55508] (2 proteins)
    characteristic HEXXHXXGXXH motif and Met located near C-terminus
  6. 2205316Protein Metalloprotease [55509] (4 species)
    the rest of protein is all-beta sandwich containing a parallel beta-helix
  7. 2205331Species Pseudomonas sp., tac ii 18 [TaxId:306] [82736] (8 PDB entries)
    psychrophilic alkaline protease
  8. 2205339Domain d1om7a2: 1om7 A:3-244 [87074]
    Other proteins in same PDB: d1om7a1
    complexed with ca, so4

Details for d1om7a2

PDB Entry: 1om7 (more details), 2.8 Å

PDB Description: crystal structure of a cold adapted alkaline protease from pseudomonas tac ii 18, soaked in 85 mm edta
PDB Compounds: (A:) serralysin

SCOPe Domain Sequences for d1om7a2:

Sequence, based on SEQRES records: (download)

>d1om7a2 d.92.1.6 (A:3-244) Metalloprotease {Pseudomonas sp., tac ii 18 [TaxId: 306]}
gtssaftqidnfshfydrgdhlvngkpsftvdqvadqltrsgaswhdlnndgvinltytf
ltappvgyasrglgtfsqfsalqkeqaklsleswadvakvtftegpaargddghmtfanf
sasnggaafaylpnssrkgeswylinkdyqvnktpgegnygrqtltheightlglshpgd
ynagngnptyrdavyaedtraysvmsywsekntgqvftktgegayasapllddiaavqkl
yg

Sequence, based on observed residues (ATOM records): (download)

>d1om7a2 d.92.1.6 (A:3-244) Metalloprotease {Pseudomonas sp., tac ii 18 [TaxId: 306]}
gtssaftqidnfshfydrgdhlvngkpsftvdqvadqltrsgaswhdndgvinltytflt
appvgyasrglgtfsqfsalqkeqaklsleswadvakvtftegpaargddghmtfanfsa
snggaafaylpnssrkgeswylinkdyqvnktpgegnygrqtltheightlglshpgdnp
tyrdavyaedtraysvmsywsekntgqvftktgegayasapllddiaavqklyg

SCOPe Domain Coordinates for d1om7a2:

Click to download the PDB-style file with coordinates for d1om7a2.
(The format of our PDB-style files is described here.)

Timeline for d1om7a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1om7a1