SCOP 1.65: Domain d1om7a1: 1om7 A:245-463

Lineage for d1om7a1 (1om7 A:245-463)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.79: beta-Roll [51119] (1 superfamily)
   contains a parallel beta-helix that binds calcium ions between its turns

4. Superfamily b.79.1: Serralysin-like metalloprotease, C-terminal domain [51120] (1 family)
   duplication: halfturs of beta-helix are sequence and structural repeats

5. Family b.79.1.1: Serralysin-like metalloprotease, C-terminal domain [51121] (1 protein)

6. Protein Metalloprotease [51122] (4 species)
   The catalitic N-terminal domain belong to the "zincin" superfamily

7. Species Pseudomonas sp., tac ii 18 [TaxId:306] [82190] (8 PDB entries)
   psychrophilic alkaline protease

8. Domain d1om7a1: 1om7 A:245-463 [87073]
   Other proteins in same PDB: d1om7a2
   complexed with ca, so4

Details for d1om7a1

PDB Entry: 1om7, 2.8 Å

PDB Description: crystal structure of a cold adapted alkaline protease from pseudomonas tac ii 18, soaked in 85 mm edta

SCOP Domain Sequences for d1om7a1:

Sequence; same for both SEQRES and ATOM records:

>d1om7a1 b.79.1.1 (A:245-463) Metalloprotease {Pseudomonas sp., tac ii 18}
anletraddtvygfnstadrdfysatsstdklifsvwdgggndtldfsgfsqnqkinlta
gsfsdvggmtgnvsiaqgvtienaiggsgndlligndaanvlkggagndiiyggggadvl
wggtgsdtfvfgavsdstpkaadiikdfqsgfdkidltaitklgglnfvdaftghagdai
vsyhqasnagslqvdfsgqgvadflvttvgqvatydiva

Timeline for d1om7a1:

• d1om7a1 is new in SCOP 1.65
  
• d1om7a1 appears in SCOP 1.67
  
• d1om7a1 appears in the current release, SCOPe 2.08