SCOP 1.65: Domain d1om6a2: 1om6 A:3-244

Lineage for d1om6a2 (1om6 A:3-244)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (14 families)

5. Family d.92.1.6: Serralysin-like metalloprotease, catalytic (N-terminal) domain [55508] (1 protein)
   characteristic HEXXHXXGXXH motif and Met located near C-terminus

6. Protein Metalloprotease [55509] (4 species)
   the rest of protein is all-beta sandwich containing a parallel beta-helix

7. Species Pseudomonas sp., tac ii 18 [TaxId:306] [82736] (8 PDB entries)
   psychrophilic alkaline protease

8. Domain d1om6a2: 1om6 A:3-244 [87072]
   Other proteins in same PDB: d1om6a1
   complexed with ca, so4

Details for d1om6a2

PDB Entry: 1om6, 2 Å

PDB Description: crystal structure of a cold adapted alkaline protease from pseudomonas tac ii 18, co-crystallized with 5mm edta (2 months)

SCOP Domain Sequences for d1om6a2:

Sequence, based on SEQRES records:

>d1om6a2 d.92.1.6 (A:3-244) Metalloprotease {Pseudomonas sp., tac ii 18}
gtssaftqidnfshfydrgdhlvngkpsftvdqvadqltrsgaswhdlnndgvinltytf
ltappvgyasrglgtfsqfsalqkeqaklsleswadvakvtftegpaargddghmtfanf
sasnggaafaylpnssrkgeswylinkdyqvnktpgegnygrqtltheightlglshpgd
ynagngnptyrdavyaedtraysvmsywsekntgqvftktgegayasapllddiaavqkl
yg

Sequence, based on observed residues (ATOM records):

>d1om6a2 d.92.1.6 (A:3-244) Metalloprotease {Pseudomonas sp., tac ii 18}
gtssaftqidnfshfydrgdhlvngkpsftvdqvadqltrsgaswhdndgvinltytflt
appvgyasrglgtfsqfsalqkeqaklsleswadvakvtftegpaargddghmtfanfsa
snggaafaylpnssrkgeswylinkdyqvnktpgegnygrqtltheightlglshpgdnp
tyrdavyaedtraysvmsywsekntgqvftktgegayasapllddiaavqklyg

Timeline for d1om6a2:

• d1om6a2 is new in SCOP 1.65
  
• d1om6a2 appears in SCOP 1.67
  
• d1om6a2 appears in the current release, SCOPe 2.08