SCOPe 2.05: Domain d1om3l2: 1om3 L:108-213

Lineage for d1om3l2 (1om3 L:108-213)

Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)

Species Human (Homo sapiens) [TaxId:9606] [88569] (144 PDB entries)
including humanized antibodies (chimeric proteins with human constant domains)
SQ NA # humanized antibody ! Uniprot P01834 # KAC_HUMAN Ig kappa chain C region ! SQ P01834 # KAC_HUMAN Ig kappa chain C region. ! SQ NA # engineered antibody

Domain d1om3l2: 1om3 L:108-213 [87064]
Other proteins in same PDB: d1om3h1, d1om3h2, d1om3k1, d1om3k2, d1om3l1, d1om3m1
part of Fab 2G12

Details for d1om3l2

PDB Entry: 1om3 (more details), 2.2 Å

PDB Description: fab 2g12 unliganded

PDB Compounds: (L:) FAB 2G12, light chain

SCOPe Domain Sequences for d1om3l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1om3l2 b.1.1.2 (L:108-213) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

SCOPe Domain Coordinates for d1om3l2:

Click to download the PDB-style file with coordinates for d1om3l2.
(The format of our PDB-style files is described here.)

Timeline for d1om3l2: