Lineage for d1om3h1 (1om3 H:1-115)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 287097Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)
  6. 287195Protein Immunoglobulin heavy chain variable domain, VH [88543] (19 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogeneous CDRs are listed as engineered species
  7. 287196Species Engineered (including hybrid species) [88562] (24 PDB entries)
  8. 287209Domain d1om3h1: 1om3 H:1-115 [87059]
    Other proteins in same PDB: d1om3h2, d1om3k2, d1om3l1, d1om3l2, d1om3m1, d1om3m2

Details for d1om3h1

PDB Entry: 1om3 (more details), 2.2 Å

PDB Description: fab 2g12 unliganded

SCOP Domain Sequences for d1om3h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1om3h1 b.1.1.1 (H:1-115) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)}
evqlvesggglvkaggslilscgvsnfrisahtmnwvrrvpggglewvasistsstyrdy
adavkgrftvsrddledfvylqmhkmrvedtaiyycarkgsdrlsdndpfdawgpgtvvt
vspas

SCOP Domain Coordinates for d1om3h1:

Click to download the PDB-style file with coordinates for d1om3h1.
(The format of our PDB-style files is described here.)

Timeline for d1om3h1: