SCOP 1.69: Domain d1okeb1: 1oke B:298-394

Lineage for d1okeb1 (1oke B:298-394)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (18 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.4: Class II viral fusion proteins C-terminal domain [81284] (2 proteins)

6. Protein Envelope glycoprotein [49213] (4 species)

7. Species Dengue virus type 2 [TaxId:12637] [89194] (6 PDB entries)

8. Domain d1okeb1: 1oke B:298-394 [87056]
   Other proteins in same PDB: d1okea2, d1okeb2

Details for d1okeb1

PDB Entry: 1oke, 2.4 Å

PDB Description: crystal structure of the dengue 2 virus envelope protein in complex with n-octyl-beta-d-glucoside

SCOP Domain Sequences for d1okeb1:

Sequence; same for both SEQRES and ATOM records:

>d1okeb1 b.1.18.4 (B:298-394) Envelope glycoprotein {Dengue virus type 2}
sysmctgkfkvvkeiaetqhgtivirvqyegdgspckipfeimdlekrhvlgrlitvnpi
vtekdspvnieaeppfgdsyiiigvepgqlklnwfkk

Timeline for d1okeb1:

• d1okeb1 first appeared in SCOP 1.65
  
• d1okeb1 appears in SCOP 1.67
  
• d1okeb1 appears in SCOP 1.71
  
• d1okeb1 appears in the current release, SCOPe 2.08