SCOP 1.75: Domain d1oi7a2: 1oi7 A:122-288

Lineage for d1oi7a2 (1oi7 A:122-288)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.4: Succinyl-CoA synthetase domains [52210] (1 family)

5. Family c.23.4.1: Succinyl-CoA synthetase domains [52211] (3 proteins)
   contain additional N-terminal strand "0", antiparallel to strand 2

6. Protein Succinyl-CoA synthetase, alpha-chain, C-terminal domain [52212] (3 species)

7. Species Thermus thermophilus [TaxId:274] [89589] (1 PDB entry)

8. Domain d1oi7a2: 1oi7 A:122-288 [87050]
   Other proteins in same PDB: d1oi7a1
   alpha-chain only
   mutant

Details for d1oi7a2

PDB Entry: 1oi7, 1.23 Å

PDB Description: the crystal structure of succinyl-coa synthetase alpha subunit from thermus thermophilus

PDB Compounds: (A:) succinyl-coa synthetase alpha chain

SCOP Domain Sequences for d1oi7a2:

Sequence, based on SEQRES records:

>d1oi7a2 c.23.4.1 (A:122-288) Succinyl-CoA synthetase, alpha-chain, C-terminal domain {Thermus thermophilus [TaxId: 274]}
ncpgiisaeetkigimpghvfkrgrvgiisrsgtltyeaaaalsqaglgttttvgiggdp
vigttfkdllplfnedpeteavvligeiggsdeeeaaawvkdhmkkpvvgfiggrsapkg
krmghagaiimgnvgtpesklrafaeagipvadtideivelvkkalg

Sequence, based on observed residues (ATOM records):

>d1oi7a2 c.23.4.1 (A:122-288) Succinyl-CoA synthetase, alpha-chain, C-terminal domain {Thermus thermophilus [TaxId: 274]}
ncpgiisaeetkigimpghvfkrgrvgiisrsgtltyeaaaalsqaglgttttvgiggdp
vigttfkdllplfnedpeteavvligeiggsdeeeaaawvkdhmkkpvvgfiggrvgtpe
sklrafaeagipvadtideivelvkkalg

Timeline for d1oi7a2:

• d1oi7a2 first appeared in SCOP 1.65
  
• d1oi7a2 appears in SCOP 1.73
  
• d1oi7a2 appears in SCOPe 2.01
  
• d1oi7a2 appears in the current release, SCOPe 2.08