Lineage for d1oi7a2 (1oi7 A:122-288)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 311051Fold c.23: Flavodoxin-like [52171] (16 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 311231Superfamily c.23.4: Succinyl-CoA synthetase domains [52210] (1 family) (S)
  5. 311232Family c.23.4.1: Succinyl-CoA synthetase domains [52211] (2 proteins)
    contain additional N-terminal strand "0", antiparallel to strand 2
  6. 311233Protein Succinyl-CoA synthetase, alpha-chain, C-terminal domain [52212] (3 species)
  7. 311250Species Thermus thermophilus [TaxId:274] [89589] (1 PDB entry)
  8. 311251Domain d1oi7a2: 1oi7 A:122-288 [87050]
    Other proteins in same PDB: d1oi7a1
    alpha-chain only
    mutant

Details for d1oi7a2

PDB Entry: 1oi7 (more details), 1.23 Å

PDB Description: the crystal structure of succinyl-coa synthetase alpha subunit from thermus thermophilus

SCOP Domain Sequences for d1oi7a2:

Sequence, based on SEQRES records: (download)

>d1oi7a2 c.23.4.1 (A:122-288) Succinyl-CoA synthetase, alpha-chain, C-terminal domain {Thermus thermophilus}
ncpgiisaeetkigimpghvfkrgrvgiisrsgtltyeaaaalsqaglgttttvgiggdp
vigttfkdllplfnedpeteavvligeiggsdeeeaaawvkdhmkkpvvgfiggrsapkg
krmghagaiimgnvgtpesklrafaeagipvadtideivelvkkalg

Sequence, based on observed residues (ATOM records): (download)

>d1oi7a2 c.23.4.1 (A:122-288) Succinyl-CoA synthetase, alpha-chain, C-terminal domain {Thermus thermophilus}
ncpgiisaeetkigimpghvfkrgrvgiisrsgtltyeaaaalsqaglgttttvgiggdp
vigttfkdllplfnedpeteavvligeiggsdeeeaaawvkdhmkkpvvgfiggrvgtpe
sklrafaeagipvadtideivelvkkalg

SCOP Domain Coordinates for d1oi7a2:

Click to download the PDB-style file with coordinates for d1oi7a2.
(The format of our PDB-style files is described here.)

Timeline for d1oi7a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1oi7a1