SCOPe 2.02: Domain d1oi7a1: 1oi7 A:1-121

Lineage for d1oi7a1 (1oi7 A:1-121)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.8: CoA-binding domain [51900] (6 proteins)

6. Protein Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain [51901] (3 species)

7. Species Thermus thermophilus [TaxId:274] [89541] (1 PDB entry)

8. Domain d1oi7a1: 1oi7 A:1-121 [87049]
   Other proteins in same PDB: d1oi7a2
   alpha-chain only

Details for d1oi7a1

PDB Entry: 1oi7, 1.23 Å

PDB Description: the crystal structure of succinyl-coa synthetase alpha subunit from thermus thermophilus

PDB Compounds: (A:) succinyl-coa synthetase alpha chain

SCOPe Domain Sequences for d1oi7a1:

Sequence; same for both SEQRES and ATOM records:

>d1oi7a1 c.2.1.8 (A:1-121) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Thermus thermophilus [TaxId: 274]}
milvnretrvlvqgitgregqfhtkqmltygtkivagvtpgkggmevlgvpvydtvkeav
ahhevdasiifvpapaaadaaleaahagiplivlitegiptldmvraveeikalgsrlig
g

Timeline for d1oi7a1:

• d1oi7a1 first appeared in SCOP 1.65
  
• d1oi7a1 appears in SCOPe 2.01
  
• d1oi7a1 appears in SCOPe 2.03
  
• d1oi7a1 appears in the current release, SCOPe 2.08