![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.8: CoA-binding domain [51900] (6 proteins) |
![]() | Protein Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain [51901] (6 species) |
![]() | Species Thermus thermophilus [TaxId:274] [89541] (1 PDB entry) |
![]() | Domain d1oi7a1: 1oi7 A:1-121 [87049] Other proteins in same PDB: d1oi7a2 alpha-chain only |
PDB Entry: 1oi7 (more details), 1.23 Å
SCOPe Domain Sequences for d1oi7a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oi7a1 c.2.1.8 (A:1-121) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Thermus thermophilus [TaxId: 274]} milvnretrvlvqgitgregqfhtkqmltygtkivagvtpgkggmevlgvpvydtvkeav ahhevdasiifvpapaaadaaleaahagiplivlitegiptldmvraveeikalgsrlig g
Timeline for d1oi7a1: