Lineage for d1oi3a2 (1oi3 A:179-368)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 414157Fold d.79: Bacillus chorismate mutase-like [55297] (7 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 414256Superfamily d.79.2: Tubulin/Dihydroxyacetone kinase C-terminal domain [55307] (2 families) (S)
  5. 414282Family d.79.2.2: Dihydroxyacetone kinase C-terminal domain [89983] (2 proteins)
  6. 414289Protein Dihydroxyacetone kinase subunit K, DhaK [89984] (1 species)
  7. 414290Species Escherichia coli [TaxId:562] [89985] (2 PDB entries)
    gene product YcgT
  8. 414293Domain d1oi3a2: 1oi3 A:179-368 [87044]
    Other proteins in same PDB: d1oi3a1, d1oi3b1

Details for d1oi3a2

PDB Entry: 1oi3 (more details), 2 Å

PDB Description: x-ray structure of the dihydroxyacetone kinase from escherichia coli

SCOP Domain Sequences for d1oi3a2:

Sequence, based on SEQRES records: (download)

>d1oi3a2 d.79.2.2 (A:179-368) Dihydroxyacetone kinase subunit K, DhaK {Escherichia coli}
sldacaelgrklnnqghsigialgactvpaagkpsftladnemefgvgihgepgidrrpf
ssldqtvdemfdtllvngsyhrtlrfwdyqqgswqeeqqtkqplqsgdrvialvnnlgat
plselygvynrlttrcqqagltiernligayctsldmtgfsitllkvddetlalwdapvh
tpalnwgk

Sequence, based on observed residues (ATOM records): (download)

>d1oi3a2 d.79.2.2 (A:179-368) Dihydroxyacetone kinase subunit K, DhaK {Escherichia coli}
sldacaelgrklnnqghsigialgacladnemefgvgihgepgidrrpfssldqtvdemf
dtllvngsyhrtlrfwdyqqgswqeeqqtkqplqsgdrvialvnnlgatplselygvynr
lttrcqqagltiernligayctsldmtgfsitllkvddetlalwdapvhtpalnwgk

SCOP Domain Coordinates for d1oi3a2:

Click to download the PDB-style file with coordinates for d1oi3a2.
(The format of our PDB-style files is described here.)

Timeline for d1oi3a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1oi3a1