Lineage for d1oi2b2 (1oi2 B:179-368)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 330739Fold d.79: Bacillus chorismate mutase-like [55297] (5 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 330825Superfamily d.79.2: Tubulin/Dihydroxyacetone kinase C-terminal domain [55307] (2 families) (S)
  5. 330843Family d.79.2.2: Dihydroxyacetone kinase C-terminal domain domain [89983] (1 protein)
  6. 330844Protein Dihydroxyacetone kinase subunit K, DhaK [89984] (1 species)
  7. 330845Species Escherichia coli [TaxId:562] [89985] (2 PDB entries)
    gene product YcgT
  8. 330847Domain d1oi2b2: 1oi2 B:179-368 [87042]
    Other proteins in same PDB: d1oi2a1, d1oi2b1
    complexed with gol, so4

Details for d1oi2b2

PDB Entry: 1oi2 (more details), 1.75 Å

PDB Description: x-ray structure of the dihydroxyacetone kinase from escherichia coli

SCOP Domain Sequences for d1oi2b2:

Sequence, based on SEQRES records: (download)

>d1oi2b2 d.79.2.2 (B:179-368) Dihydroxyacetone kinase subunit K, DhaK {Escherichia coli}
sldacaelgrklnnqghsigialgactvpaagkpsftladnemefgvgihgepgidrrpf
ssldqtvdemfdtllvngsyhrtlrfwdyqqgswqeeqqtkqplqsgdrvialvnnlgat
plselygvynrlttrcqqagltiernligayctsldmtgfsitllkvddetlalwdapvh
tpalnwgk

Sequence, based on observed residues (ATOM records): (download)

>d1oi2b2 d.79.2.2 (B:179-368) Dihydroxyacetone kinase subunit K, DhaK {Escherichia coli}
sldacaelgrklnnqghsigialgacladnemefgvgihgepgidrrpfssldqtvdemf
dtllvngsyhrtlrfwdyqqgswqeeqqtkqplqsgdrvialvnnlgatplselygvynr
lttrcqqagltiernligayctsldmtgfsitllkvddetlalwdapvhtpalnwgk

SCOP Domain Coordinates for d1oi2b2:

Click to download the PDB-style file with coordinates for d1oi2b2.
(The format of our PDB-style files is described here.)

Timeline for d1oi2b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1oi2b1