Lineage for d1oi2b1 (1oi2 B:20-178)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 392946Fold c.32: Tubulin/Dihydroxyacetone kinase nucleotide-binding domain [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 392947Superfamily c.32.1: Tubulin/Dihydroxyacetone kinase nucleotide-binding domain [52490] (2 families) (S)
  5. 392973Family c.32.1.2: Dihydroxyacetone kinase ATPase domain [89640] (2 proteins)
  6. 392980Protein Dihydroxyacetone kinase subunit K, DhaK [89641] (1 species)
  7. 392981Species Escherichia coli [TaxId:562] [89642] (2 PDB entries)
    gene product YcgT
  8. 392983Domain d1oi2b1: 1oi2 B:20-178 [87041]
    Other proteins in same PDB: d1oi2a2, d1oi2b2
    complexed with gol, so4

Details for d1oi2b1

PDB Entry: 1oi2 (more details), 1.75 Å

PDB Description: x-ray structure of the dihydroxyacetone kinase from escherichia coli

SCOP Domain Sequences for d1oi2b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oi2b1 c.32.1.2 (B:20-178) Dihydroxyacetone kinase subunit K, DhaK {Escherichia coli}
dvldeqlaglakahpsltlhqdpvyvtradapvagkvallsgggsghepmhcgyigqgml
sgacpgeiftsptpdkifecamqvdggegvlliiknytgdilnfetatellhdsgvkvtt
vvidddvavkdslytagrrgvantvlieklvgaaaergd

SCOP Domain Coordinates for d1oi2b1:

Click to download the PDB-style file with coordinates for d1oi2b1.
(The format of our PDB-style files is described here.)

Timeline for d1oi2b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1oi2b2