Lineage for d1oi2a1 (1oi2 A:20-178)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 312860Fold c.32: Tubulin/Dihydroxyacetone kinase nucleotide-binding domain [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 312861Superfamily c.32.1: Tubulin/Dihydroxyacetone kinase nucleotide-binding domain [52490] (2 families) (S)
  5. 312879Family c.32.1.2: Dihydroxyacetone kinase ATPase domain [89640] (1 protein)
  6. 312880Protein Dihydroxyacetone kinase subunit K, DhaK [89641] (1 species)
  7. 312881Species Escherichia coli [TaxId:562] [89642] (2 PDB entries)
    gene product YcgT
  8. 312882Domain d1oi2a1: 1oi2 A:20-178 [87039]
    Other proteins in same PDB: d1oi2a2, d1oi2b2

Details for d1oi2a1

PDB Entry: 1oi2 (more details), 1.75 Å

PDB Description: x-ray structure of the dihydroxyacetone kinase from escherichia coli

SCOP Domain Sequences for d1oi2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oi2a1 c.32.1.2 (A:20-178) Dihydroxyacetone kinase subunit K, DhaK {Escherichia coli}
dvldeqlaglakahpsltlhqdpvyvtradapvagkvallsgggsghepmhcgyigqgml
sgacpgeiftsptpdkifecamqvdggegvlliiknytgdilnfetatellhdsgvkvtt
vvidddvavkdslytagrrgvantvlieklvgaaaergd

SCOP Domain Coordinates for d1oi2a1:

Click to download the PDB-style file with coordinates for d1oi2a1.
(The format of our PDB-style files is described here.)

Timeline for d1oi2a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1oi2a2