Lineage for d1ohhh_ (1ohh H:)

  1. Root: SCOP 1.67
  2. 431023Class h: Coiled coil proteins [57942] (6 folds)
  3. 432009Fold h.4: Antiparallel coiled-coil [58086] (15 superfamilies)
    this is not a true fold; contains at least two very long antiparallel helices
  4. 432074Superfamily h.4.8: F1 ATPase inhibitor, IF1, C-terminal domain [64602] (1 family) (S)
  5. 432075Family h.4.8.1: F1 ATPase inhibitor, IF1, C-terminal domain [64603] (1 protein)
  6. 432076Protein F1 ATPase inhibitor, IF1, C-terminal domain [64604] (1 species)
    antiparallel right-handed coiled-coil
  7. 432077Species Cow (Bos taurus) [TaxId:9913] [64605] (3 PDB entries)
  8. 432084Domain d1ohhh_: 1ohh H: [87034]
    Other proteins in same PDB: d1ohha1, d1ohha2, d1ohha3, d1ohhb1, d1ohhb2, d1ohhb3, d1ohhc1, d1ohhc2, d1ohhc3, d1ohhd1, d1ohhd2, d1ohhd3, d1ohhe1, d1ohhe2, d1ohhe3, d1ohhf1, d1ohhf2, d1ohhf3, d1ohhg_
    complexed with anp, mg

Details for d1ohhh_

PDB Entry: 1ohh (more details), 2.8 Å

PDB Description: bovine mitochondrial f1-atpase complexed with the inhibitor protein if1

SCOP Domain Sequences for d1ohhh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ohhh_ h.4.8.1 (H:) F1 ATPase inhibitor, IF1, C-terminal domain {Cow (Bos taurus)}
sgdnvrssagavrdaggafgkreqaeeeryfrarake

SCOP Domain Coordinates for d1ohhh_:

Click to download the PDB-style file with coordinates for d1ohhh_.
(The format of our PDB-style files is described here.)

Timeline for d1ohhh_: