![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145, strand 5 is antiparallel to the rest |
![]() | Superfamily c.49.2: ATP synthase (F1-ATPase), gamma subunit [52943] (2 families) ![]() contains an antiparallel coiled coil formed by N- and C-terminal extensions to the common fold |
![]() | Family c.49.2.1: ATP synthase (F1-ATPase), gamma subunit [52944] (1 protein) |
![]() | Protein ATP synthase (F1-ATPase), gamma subunit [52945] (3 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [52946] (19 PDB entries) Uniprot P05631 |
![]() | Domain d1ohhg_: 1ohh G: [87033] Other proteins in same PDB: d1ohha1, d1ohha2, d1ohha3, d1ohhb1, d1ohhb2, d1ohhb3, d1ohhc1, d1ohhc2, d1ohhc3, d1ohhd1, d1ohhd2, d1ohhd3, d1ohhe1, d1ohhe2, d1ohhe3, d1ohhf1, d1ohhf2, d1ohhf3, d1ohhh_ core domain is disordered; only coiled coil part is visible complexed with anp, mg |
PDB Entry: 1ohh (more details), 2.8 Å
SCOPe Domain Sequences for d1ohhg_:
Sequence, based on SEQRES records: (download)
>d1ohhg_ c.49.2.1 (G:) ATP synthase (F1-ATPase), gamma subunit {Cow (Bos taurus) [TaxId: 9913]} atlkditrrlksikniqkitksmkmvaaakyaraerelkparvygvgslalyekadiktp edkkkhliigvssdrglcgaihssvakqmkseaanlaaagkevkiigvgdkirsilhrth sdqflvtfkevgrrpptfgdasvialellnsgyefdegsiifnrfrsvisykteekpifs ldtissaesmsiyddidadvlrnyqeyslaniiyyslkesttseqsarmtamdnasknas emidkltltfnrtrqavitkelieiisgaaal
>d1ohhg_ c.49.2.1 (G:) ATP synthase (F1-ATPase), gamma subunit {Cow (Bos taurus) [TaxId: 9913]} atlkditrrlksikniqkitksmkmvaaaklcgaihssvakqttseqsarmtamdnaskn asemidkltltfnrtrqavitkelieiisgaaal
Timeline for d1ohhg_: