Class a: All alpha proteins [46456] (202 folds) |
Fold a.69: Left-handed superhelix [47916] (3 superfamilies) core: 4-5 helices; bundle; left-handed superhelix |
Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (1 family) |
Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (2 proteins) |
Protein F1 ATP synthase beta subunit, domain 3 [88928] (4 species) |
Species Cow (Bos taurus) [TaxId:9913] [88929] (10 PDB entries) |
Domain d1ohhf1: 1ohh F:358-474 [87030] Other proteins in same PDB: d1ohha1, d1ohha2, d1ohha3, d1ohhb1, d1ohhb2, d1ohhb3, d1ohhc1, d1ohhc2, d1ohhc3, d1ohhd2, d1ohhd3, d1ohhe2, d1ohhe3, d1ohhf2, d1ohhf3, d1ohhg_, d1ohhh_ complexed with anp, mg |
PDB Entry: 1ohh (more details), 2.8 Å
SCOP Domain Sequences for d1ohhf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ohhf1 a.69.1.1 (F:358-474) F1 ATP synthase beta subunit, domain 3 {Cow (Bos taurus)} mdpnivgsehydvargvqkilqdykslqdiiailgmdelseedkltvsrarkiqrflsqp fqvaevftghlgklvplketikgfqqilageydhlpeqafymvgpieeavakadkla
Timeline for d1ohhf1: