SCOPe 2.02: Domain d1ohhe2: 1ohh E:9-81

Lineage for d1ohhe2 (1ohh E:9-81)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
   barrel, closed; n=6, S=8; greek-key

4. Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (1 family)

5. Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (2 proteins)
   6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?)

6. Protein F1 ATP synthase beta subunit, domain 1 [88677] (4 species)

7. Species Cow (Bos taurus) [TaxId:9913] [88678] (14 PDB entries)
   Uniprot P00829

8. Domain d1ohhe2: 1ohh E:9-81 [87028]
   Other proteins in same PDB: d1ohha1, d1ohha2, d1ohha3, d1ohhb1, d1ohhb2, d1ohhb3, d1ohhc1, d1ohhc2, d1ohhc3, d1ohhd1, d1ohhd3, d1ohhe1, d1ohhe3, d1ohhf1, d1ohhf3, d1ohhg_, d1ohhh_
   complexed with anp, mg

Details for d1ohhe2

PDB Entry: 1ohh, 2.8 Å

PDB Description: bovine mitochondrial f1-atpase complexed with the inhibitor protein if1

PDB Compounds: (E:) ATP synthase beta chain, mitochondrial

SCOPe Domain Sequences for d1ohhe2:

Sequence; same for both SEQRES and ATOM records:

>d1ohhe2 b.49.1.1 (E:9-81) F1 ATP synthase beta subunit, domain 1 {Cow (Bos taurus) [TaxId: 9913]}
ttgrivavigavvdvqfdeglppilnalevqgretrlvlevaqhlgestvrtiamdgteg
lvrgqkvldsgap

Timeline for d1ohhe2:

• d1ohhe2 first appeared in SCOP 1.65
  
• d1ohhe2 appears in SCOPe 2.01
  
• d1ohhe2 appears in SCOPe 2.03
  
• d1ohhe2 appears in the current release, SCOPe 2.08