Lineage for d1ohhe1 (1ohh E:358-474)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 643803Fold a.69: Left-handed superhelix [47916] (3 superfamilies)
    core: 4-5 helices; bundle; left-handed superhelix
  4. 643804Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (1 family) (S)
  5. 643805Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (2 proteins)
  6. 643851Protein F1 ATP synthase beta subunit, domain 3 [88928] (4 species)
  7. 643854Species Cow (Bos taurus) [TaxId:9913] [88929] (12 PDB entries)
  8. 643886Domain d1ohhe1: 1ohh E:358-474 [87027]
    Other proteins in same PDB: d1ohha1, d1ohha2, d1ohha3, d1ohhb1, d1ohhb2, d1ohhb3, d1ohhc1, d1ohhc2, d1ohhc3, d1ohhd2, d1ohhd3, d1ohhe2, d1ohhe3, d1ohhf2, d1ohhf3, d1ohhg_, d1ohhh_

Details for d1ohhe1

PDB Entry: 1ohh (more details), 2.8 Å

PDB Description: bovine mitochondrial f1-atpase complexed with the inhibitor protein if1
PDB Compounds: (E:) ATP synthase beta chain, mitochondrial

SCOP Domain Sequences for d1ohhe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ohhe1 a.69.1.1 (E:358-474) F1 ATP synthase beta subunit, domain 3 {Cow (Bos taurus) [TaxId: 9913]}
mdpnivgsehydvargvqkilqdykslqdiiailgmdelseedkltvsrarkiqrflsqp
fqvaevftghlgklvplketikgfqqilageydhlpeqafymvgpieeavakadkla

SCOP Domain Coordinates for d1ohhe1:

Click to download the PDB-style file with coordinates for d1ohhe1.
(The format of our PDB-style files is described here.)

Timeline for d1ohhe1: