Lineage for d1ohhc3 (1ohh C:95-379)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 313180Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 313181Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (21 families) (S)
    division into families based on beta-sheet topologies
  5. 314141Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (11 proteins)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. 314194Protein Central domain of alpha subunit of F1 ATP synthase [88774] (4 species)
  7. 314197Species Cow (Bos taurus) [TaxId:9913] [88775] (10 PDB entries)
  8. 314224Domain d1ohhc3: 1ohh C:95-379 [87023]
    Other proteins in same PDB: d1ohha1, d1ohha2, d1ohhb1, d1ohhb2, d1ohhc1, d1ohhc2, d1ohhd1, d1ohhd2, d1ohhd3, d1ohhe1, d1ohhe2, d1ohhe3, d1ohhf1, d1ohhf2, d1ohhf3, d1ohhg_, d1ohhh_
    complexed with anp, mg

Details for d1ohhc3

PDB Entry: 1ohh (more details), 2.8 Å

PDB Description: bovine mitochondrial f1-atpase complexed with the inhibitor protein if1

SCOP Domain Sequences for d1ohhc3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ohhc3 c.37.1.11 (C:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus)}
vdvpvgeellgrvvdalgnaidgkgpigskarrrvglkapgiiprisvrepmqtgikavd
slvpigrgqreliigdrqtgktsiaidtiinqkrfndgtdekkklyciyvaigqkrstva
qlvkrltdadamkytivvsatasdaaplqylapysgcsmgeyfrdngkhaliiyddlskq
avayrqmslllrrppgreaypgdvfylhsrlleraakmndafgggsltalpvietqagdv
sayiptnvisitdgqifletelfykgirpainvglsvsrvgsaaq

SCOP Domain Coordinates for d1ohhc3:

Click to download the PDB-style file with coordinates for d1ohhc3.
(The format of our PDB-style files is described here.)

Timeline for d1ohhc3: