SCOP 1.71: Domain d1ohhc2: 1ohh C:19-94

Lineage for d1ohhc2 (1ohh C:19-94)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
   barrel, closed; n=6, S=8; greek-key

4. Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (1 family)

5. Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (2 proteins)
   6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?)

6. Protein F1 ATP synthase alpha subunit, domain 1 [88672] (4 species)

7. Species Cow (Bos taurus) [TaxId:9913] [88673] (12 PDB entries)

8. Domain d1ohhc2: 1ohh C:19-94 [87022]
   Other proteins in same PDB: d1ohha1, d1ohha3, d1ohhb1, d1ohhb3, d1ohhc1, d1ohhc3, d1ohhd1, d1ohhd2, d1ohhd3, d1ohhe1, d1ohhe2, d1ohhe3, d1ohhf1, d1ohhf2, d1ohhf3, d1ohhg_, d1ohhh_
   complexed with anp, mg

Details for d1ohhc2

PDB Entry: 1ohh, 2.8 Å

PDB Description: bovine mitochondrial f1-atpase complexed with the inhibitor protein if1

SCOP Domain Sequences for d1ohhc2:

Sequence; same for both SEQRES and ATOM records:

>d1ohhc2 b.49.1.1 (C:19-94) F1 ATP synthase alpha subunit, domain 1 {Cow (Bos taurus)}
adtsvdleetgrvlsigdgiarvhglrnvqaeemvefssglkgmslnlepdnvgvvvfgn
dklikegdivkrtgai

Timeline for d1ohhc2:

• d1ohhc2 first appeared in SCOP 1.65
  
• d1ohhc2 appears in SCOP 1.69
  
• d1ohhc2 appears in SCOP 1.73
  
• d1ohhc2 appears in the current release, SCOPe 2.08