SCOPe 2.08: Domain d1ohhc1: 1ohh C:380-510

Lineage for d1ohhc1 (1ohh C:380-510)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
   core: 4-5 helices; bundle; left-handed superhelix

4. Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (4 families)

5. Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (2 proteins)

6. Protein F1 ATP synthase alpha subunit, domain 3 [88886] (5 species)

7. Species Cow (Bos taurus) [TaxId:9913] [88893] (15 PDB entries)
   Uniprot P19483

8. Domain d1ohhc1: 1ohh C:380-510 [87021]
   Other proteins in same PDB: d1ohha2, d1ohha3, d1ohhb2, d1ohhb3, d1ohhc2, d1ohhc3, d1ohhd1, d1ohhd2, d1ohhd3, d1ohhe1, d1ohhe2, d1ohhe3, d1ohhf1, d1ohhf2, d1ohhf3, d1ohhg_, d1ohhh_
   complexed with anp, mg

Details for d1ohhc1

PDB Entry: 1ohh, 2.8 Å

PDB Description: bovine mitochondrial f1-atpase complexed with the inhibitor protein if1

PDB Compounds: (C:) ATP synthase alpha chain heart isoform, mitochondrial

SCOPe Domain Sequences for d1ohhc1:

Sequence, based on SEQRES records:

>d1ohhc1 a.69.1.1 (C:380-510) F1 ATP synthase alpha subunit, domain 3 {Cow (Bos taurus) [TaxId: 9913]}
tramkqvagtmklelaqyrevaafaqfgsdldaatqqllsrgvrltellkqgqyspmaie
eqvaviyagvrgyldklepskitkfenaflshvisqhqallgkirtdgkiseesdaklke
ivtnflagfea

Sequence, based on observed residues (ATOM records):

>d1ohhc1 a.69.1.1 (C:380-510) F1 ATP synthase alpha subunit, domain 3 {Cow (Bos taurus) [TaxId: 9913]}
tramkqvagtmklelaqyrevaafadldaatqqllsrgvrltellkqgqyspmaieeqva
viyagvrgyldklepskitkfenaflshvisqhqallgkirtdgkiseesdaklkeivtn
flagfea

Timeline for d1ohhc1:

• d1ohhc1 first appeared in SCOP 1.65
  
• d1ohhc1 appears in SCOPe 2.07