SCOPe 2.08: Domain d1ohea2: 1ohe A:199-380

Lineage for d1ohea2 (1ohe A:199-380)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423

4. Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families)
   share with the family I the common active site structure with a circularly permuted topology

5. Family c.45.1.1: Dual specificity phosphatase-like [52800] (9 proteins)

6. Protein Proline directed phosphatase CDC14b2 [89698] (1 species)
   duplication: consists of two structurally similar domains with the catalytic site being in the C-terminal domain

7. Species Human (Homo sapiens) [TaxId:9606] [89699] (3 PDB entries)

8. Domain d1ohea2: 1ohe A:199-380 [87014]

Details for d1ohea2

PDB Entry: 1ohe, 2.2 Å

PDB Description: structure of cdc14b phosphatase with a peptide ligand

PDB Compounds: (A:) cdc14b2 phosphatase

SCOPe Domain Sequences for d1ohea2:

Sequence; same for both SEQRES and ATOM records:

>d1ohea2 c.45.1.1 (A:199-380) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]}
sfnldeyehyekaengdlnwiipdrfiafcgphsrarlesgyhqhspetyiqyfknhnvt
tiirlnkrmydakrftdagfdhhdlffadgstptdaivkefldicenaegaiavhskagl
grtgtliacyimkhyrmtaaetiawvricrpgsvigpqqqflvmkqtnlwlegdyfrqkl
kg

Timeline for d1ohea2:

• d1ohea2 first appeared in SCOP 1.65
  
• d1ohea2 appears in SCOPe 2.07