Lineage for d1ogsb1 (1ogs B:1-77,B:432-497)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 469403Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 469404Superfamily b.71.1: Glycosyl hydrolase domain [51011] (3 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 469695Family b.71.1.2: Composite domain of glycosyl hydrolase families 5, 30, 39 and 51 [89388] (4 proteins)
    interrupted by the catalytic domain; the C-terminal core is similar to the alpha-amylase domain
  6. 469714Protein Glucosylceramidase [89389] (1 species)
    glycosyl hydrolase family 30; the N-terminal extension wraps around the C-terminal core
  7. 469715Species Human (Homo sapiens) [TaxId:9606] [89390] (1 PDB entry)
  8. 469717Domain d1ogsb1: 1ogs B:1-77,B:432-497 [86999]
    Other proteins in same PDB: d1ogsa2, d1ogsb2

Details for d1ogsb1

PDB Entry: 1ogs (more details), 2 Å

PDB Description: human acid-beta-glucosidase

SCOP Domain Sequences for d1ogsb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ogsb1 b.71.1.2 (B:1-77,B:432-497) Glucosylceramidase {Human (Homo sapiens)}
arpcipksfgyssvvcvcnatycdsfdpptfpalgtfsryestrsgrrmelsmgpiqanh
tgtgllltlqpeqkfqkXqrvglvasqkndldavalmhpdgsavvvvlnrsskdvpltik
dpavgfletispgysihtylwhrq

SCOP Domain Coordinates for d1ogsb1:

Click to download the PDB-style file with coordinates for d1ogsb1.
(The format of our PDB-style files is described here.)

Timeline for d1ogsb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ogsb2