Lineage for d1ogsa2 (1ogs A:78-431)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 473233Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 474052Superfamily c.1.8: (Trans)glycosidases [51445] (11 families) (S)
  5. 474407Family c.1.8.3: beta-glycanases [51487] (22 proteins)
    consist of a number of sequence families
  6. 474655Protein Glucosylceramidase, catalytic domain [89473] (1 species)
    acid-beta-glucosidase; glycosyl hydrolase family 30; contains additional beta-domain similar to one found in alpha amylases
  7. 474656Species Human (Homo sapiens) [TaxId:9606] [89474] (1 PDB entry)
  8. 474657Domain d1ogsa2: 1ogs A:78-431 [86998]
    Other proteins in same PDB: d1ogsa1, d1ogsb1

Details for d1ogsa2

PDB Entry: 1ogs (more details), 2 Å

PDB Description: human acid-beta-glucosidase

SCOP Domain Sequences for d1ogsa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ogsa2 c.1.8.3 (A:78-431) Glucosylceramidase, catalytic domain {Human (Homo sapiens)}
vkgfggamtdaaalnilalsppaqnlllksyfseegigyniirvpmascdfsirtytyad
tpddfqlhnfslpeedtklkiplihralqlaqrpvsllaspwtsptwlktngavngkgsl
kgqpgdiyhqtwaryfvkfldayaehklqfwavtaenepsagllsgypfqclgftpehqr
dfiardlgptlansthhnvrllmlddqrlllphwakvvltdpeaakyvhgiavhwyldfl
apakatlgethrlfpntmlfaseacvgskfweqsvrlgswdrgmqyshsiitnllyhvvg
wtdwnlalnpeggpnwvrnfvdspiivditkdtfykqpmfyhlghfskfipegs

SCOP Domain Coordinates for d1ogsa2:

Click to download the PDB-style file with coordinates for d1ogsa2.
(The format of our PDB-style files is described here.)

Timeline for d1ogsa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ogsa1