SCOP 1.65: Domain d1ogae1: 1oga E:5-118

Lineage for d1ogae1 (1oga E:5-118)

Root: SCOP 1.65
Class b: All beta proteins [48724] (126 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (4 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)
Protein T-cell antigen receptor [48933] (6 species)
sequences may differ within each classified species
Species Human (Homo sapiens), beta-chain [TaxId:9606] [48937] (11 PDB entries)
Domain d1ogae1: 1oga E:5-118 [86992]
Other proteins in same PDB: d1ogaa1, d1ogaa2, d1ogab_, d1ogad2, d1ogae2

Details for d1ogae1

PDB Entry: 1oga (more details), 1.4 Å

PDB Description: a structural basis for immunodominant human t-cell receptor recognition.

SCOP Domain Sequences for d1ogae1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ogae1 b.1.1.1 (E:5-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain}
gitqspkylfrkegqnvtlsceqnlnhdamywyrqdpgqglrliyysqivndfqkgdiae
gysvsrekkesfpltvtsaqknptafylcasssrssyeqyfgpgtrltvtedlk

SCOP Domain Coordinates for d1ogae1:

Click to download the PDB-style file with coordinates for d1ogae1.
(The format of our PDB-style files is described here.)

Timeline for d1ogae1: