SCOP 1.67: Domain d1ogad2: 1oga D:118-202

Lineage for d1ogad2 (1oga D:118-202)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein T-cell antigen receptor [49125] (6 species)

7. Species Human (Homo sapiens), alpha-chain [TaxId:9606] [49127] (9 PDB entries)

8. Domain d1ogad2: 1oga D:118-202 [86991]
   Other proteins in same PDB: d1ogaa1, d1ogaa2, d1ogab_, d1ogad1, d1ogae1

Details for d1ogad2

PDB Entry: 1oga, 1.4 Å

PDB Description: a structural basis for immunodominant human t-cell receptor recognition.

SCOP Domain Sequences for d1ogad2:

Sequence; same for both SEQRES and ATOM records:

>d1ogad2 b.1.1.2 (D:118-202) T-cell antigen receptor {Human (Homo sapiens), alpha-chain}
pavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdktvldmrsmdfksnsavaws
nksdfacanafnnsiipedtffpsp

Timeline for d1ogad2:

• d1ogad2 first appeared in SCOP 1.65
  
• d1ogad2 appears in SCOP 1.69
  
• d1ogad2 appears in the current release, SCOPe 2.08