Lineage for d1ogad2 (1oga D:118-202)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 288543Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 290095Protein T-cell antigen receptor [49125] (6 species)
  7. 290096Species Human (Homo sapiens), alpha-chain [TaxId:9606] [49127] (9 PDB entries)
  8. 290097Domain d1ogad2: 1oga D:118-202 [86991]
    Other proteins in same PDB: d1ogaa1, d1ogaa2, d1ogab_, d1ogad1, d1ogae1

Details for d1ogad2

PDB Entry: 1oga (more details), 1.4 Å

PDB Description: a structural basis for immunodominant human t-cell receptor recognition.

SCOP Domain Sequences for d1ogad2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ogad2 b.1.1.2 (D:118-202) T-cell antigen receptor {Human (Homo sapiens), alpha-chain}
pavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdktvldmrsmdfksnsavaws
nksdfacanafnnsiipedtffpsp

SCOP Domain Coordinates for d1ogad2:

Click to download the PDB-style file with coordinates for d1ogad2.
(The format of our PDB-style files is described here.)

Timeline for d1ogad2: