Class b: All beta proteins [48724] (141 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
Protein beta2-microglobulin [88600] (4 species) |
Species Human (Homo sapiens) [TaxId:9606] [88602] (80 PDB entries) |
Domain d1ogab_: 1oga B: [86989] Other proteins in same PDB: d1ogaa1, d1ogaa2, d1ogad1, d1ogad2, d1ogae1, d1ogae2 |
PDB Entry: 1oga (more details), 1.4 Å
SCOP Domain Sequences for d1ogab_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ogab_ b.1.1.2 (B:) beta2-microglobulin {Human (Homo sapiens)} miqrtpkiqvysrhpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskd wsfyllyyteftptekdeyacrvnhvtlsqpkivkwdrdm
Timeline for d1ogab_: