Class b: All beta proteins [48724] (141 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
Protein Class I MHC, alpha-3 domain [88604] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [88605] (65 PDB entries) |
Domain d1ogaa1: 1oga A:182-276 [86987] Other proteins in same PDB: d1ogaa2, d1ogab_, d1ogad1, d1ogad2, d1ogae1, d1ogae2 |
PDB Entry: 1oga (more details), 1.4 Å
SCOP Domain Sequences for d1ogaa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ogaa1 b.1.1.2 (A:182-276) Class I MHC, alpha-3 domain {Human (Homo sapiens)} tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf qkwaavvvpsgqeqrytchvqheglpkpltlrwep
Timeline for d1ogaa1: