Lineage for d1ofdb3 (1ofd B:1-430)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988341Family d.153.1.1: Class II glutamine amidotransferases [56236] (6 proteins)
    has slightly different topology than other families do
  6. 2988342Protein Alpha subunit of glutamate synthase, N-terminal domain [69833] (2 species)
  7. 2988352Species Synechocystis sp. [TaxId:1143] [75566] (5 PDB entries)
  8. 2988354Domain d1ofdb3: 1ofd B:1-430 [86940]
    Other proteins in same PDB: d1ofda1, d1ofda2, d1ofdb1, d1ofdb2
    complexed with akg, f3s, fmn
    has additional subdomain(s) that are not in the common domain

Details for d1ofdb3

PDB Entry: 1ofd (more details), 2 Å

PDB Description: glutamate synthase from synechocystis sp in complex with 2-oxoglutarate at 2.0 angstrom resolution
PDB Compounds: (B:) ferredoxin-dependent glutamate synthase 2

SCOPe Domain Sequences for d1ofdb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ofdb3 d.153.1.1 (B:1-430) Alpha subunit of glutamate synthase, N-terminal domain {Synechocystis sp. [TaxId: 1143]}
cgvgfianlrgkpdhtlveqalkalgcmehrggcsadndsgdgagvmtaiprellaqwfn
trnlpmpdgdrlgvgmvflpqepsarevarayveevvrlekltvlgwrevpvnsdvlgiq
aknnqphieqilvtcpegcagdeldrrlyiarsiigkklaedfyvcsfscrtivykgmvr
siilgefyldlknpgytsnfavyhrrfstntmpkwplaqpmrllghngeintllgninwm
aarekelevsgwtkaelealtpivnqansdsynldsalellvrtgrspleaamilvpeay
knqpalkdypeisdfhdyysglqepwdgpallvfsdgkivgagldrnglrparycitkdd
yivlgseagvvdlpevdivekgrlapgqmiavdlaeqkilknyqikqqaaqkypygewik
iqrqtvasds

SCOPe Domain Coordinates for d1ofdb3:

Click to download the PDB-style file with coordinates for d1ofdb3.
(The format of our PDB-style files is described here.)

Timeline for d1ofdb3: