Lineage for d1oepa2 (1oep A:-2-138)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 411574Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 411575Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family) (S)
  5. 411576Family d.54.1.1: Enolase N-terminal domain-like [54827] (9 proteins)
    C-terminal domain is beta/alpha-barrel
  6. 411621Protein Enolase [54828] (5 species)
  7. 411657Species Trypanosoma brucei brucei [TaxId:5702] [89925] (1 PDB entry)
  8. 411658Domain d1oepa2: 1oep A:-2-138 [86919]
    Other proteins in same PDB: d1oepa1
    complexed with edo, so4, zn

Details for d1oepa2

PDB Entry: 1oep (more details), 2.3 Å

PDB Description: structure of trypanosoma brucei enolase reveals the inhibitory divalent metal site

SCOP Domain Sequences for d1oepa2:

Sequence, based on SEQRES records: (download)

>d1oepa2 d.54.1.1 (A:-2-138) Enolase {Trypanosoma brucei brucei}
shmtiqkvhgrevldsrgnptvevevttekgvfrsavpsgastgvyeacelrdgdkkryv
gkgclqavknvnevigpaligrdelkqeeldtlmlrldgtpnkgklganailgcsmaisk
aaaaakgvplyrylaslagt

Sequence, based on observed residues (ATOM records): (download)

>d1oepa2 d.54.1.1 (A:-2-138) Enolase {Trypanosoma brucei brucei}
shmtiqkvhgrevldsrgnptvevevttekgvfrsavpsgasvyeacelrdgdkkryvgk
gclqavknvnevigpaligrdelkqeeldtlmlrldgtpnkgklganailgcsmaiskaa
aaakgvplyrylaslagt

SCOP Domain Coordinates for d1oepa2:

Click to download the PDB-style file with coordinates for d1oepa2.
(The format of our PDB-style files is described here.)

Timeline for d1oepa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1oepa1