Lineage for d1oepa1 (1oep A:139-429)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 305036Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 307002Superfamily c.1.11: Enolase C-terminal domain-like [51604] (2 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this family
  5. 307003Family c.1.11.1: Enolase [51605] (1 protein)
  6. 307004Protein Enolase [51606] (5 species)
    Fold of this protein slightly differs from common fold in topology
  7. 307036Species Trypanosoma brucei brucei [TaxId:5702] [89497] (1 PDB entry)
  8. 307037Domain d1oepa1: 1oep A:139-429 [86918]
    Other proteins in same PDB: d1oepa2
    complexed with edo, so4, zn

Details for d1oepa1

PDB Entry: 1oep (more details), 2.3 Å

PDB Description: structure of trypanosoma brucei enolase reveals the inhibitory divalent metal site
PDB Compounds: (A:)

SCOP Domain Sequences for d1oepa1:

Sequence, based on SEQRES records: (download)

>d1oepa1 c.1.11.1 (A:139-429) Enolase {Trypanosoma brucei brucei}
kelrlpvpcfnvinggkhagnalpfqefmiapvkatsfsealrmgsevyhslkgiikkky
gqdavnvgdeggfappikdineplpilmeaieeaghrgkfaicmdcaasetydekkqqyn
ltfkspeptwvtaeqlretyckwahdypivsiedpydqddfagfagitealkgktqivgd
dltvtnterikmaiekkacnslllkinqigtiseaiassklcmengwsvmvshrsgeted
tyiadlvvalgsgqiktgapcrgertaklnqllrieeelgahakfgfpgws

Sequence, based on observed residues (ATOM records): (download)

>d1oepa1 c.1.11.1 (A:139-429) Enolase {Trypanosoma brucei brucei}
kelrlpvpcfnvinggkhagnalpfqefmiapvkatsfsealrmgsevyhslkgiikkky
gqdavnvgdeggfappikdineplpilmeaieeaghrgkfaicmdcaasetydekkqqyn
ltwvtaeqlretyckwahdypivsiedpydqddfagfagitealkgktqivgddltvtnt
erikmaiekkacnslllkinqigtiseaiassklcmengwsvmvshrsgetedtyiadlv
valgsgqiktgapcrgertaklnqllrieeelgahakfgfpgws

SCOP Domain Coordinates for d1oepa1:

Click to download the PDB-style file with coordinates for d1oepa1.
(The format of our PDB-style files is described here.)

Timeline for d1oepa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1oepa2