Lineage for d1oeox_ (1oeo X:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 315136Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1432
  4. 315137Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (2 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 315174Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (3 proteins)
    has an extension to the beta-sheet of 3 antiparallel strands before strand 4
  6. 315185Protein Tyrosine phosphatase [52806] (8 species)
  7. 315186Species Human (Homo sapiens), 1B [TaxId:9606] [52807] (48 PDB entries)
  8. 315203Domain d1oeox_: 1oeo X: [86917]
    complexed with ocs

Details for d1oeox_

PDB Entry: 1oeo (more details), 2.15 Å

PDB Description: ptp1b with the catalytic cysteine oxidized to sulfonic acid

SCOP Domain Sequences for d1oeox_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oeox_ c.45.1.2 (X:) Tyrosine phosphatase {Human (Homo sapiens), 1B}
emekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsriklhq
edndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmekgslkc
aqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhyttwpd
fgvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmdkrkdp
ssvdikkvllemrkfrmgliqtadqlrfsylaviegakfim

SCOP Domain Coordinates for d1oeox_:

Click to download the PDB-style file with coordinates for d1oeox_.
(The format of our PDB-style files is described here.)

Timeline for d1oeox_: