Lineage for d1oe7b1 (1oe7 B:85-207)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1491601Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1491602Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1491603Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 1491614Protein Class alpha GST [81349] (8 species)
  7. 1491615Species Blood fluke (Schistosoma haematobium) [TaxId:6185] [89060] (4 PDB entries)
  8. 1491619Domain d1oe7b1: 1oe7 B:85-207 [86903]
    Other proteins in same PDB: d1oe7a2, d1oe7b2
    complexed with gsh

Details for d1oe7b1

PDB Entry: 1oe7 (more details), 1.8 Å

PDB Description: 28kda glutathione s-transferase from schistosoma haematobium
PDB Compounds: (B:) glutathione s-transferase

SCOPe Domain Sequences for d1oe7b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oe7b1 a.45.1.1 (B:85-207) Class alpha GST {Blood fluke (Schistosoma haematobium) [TaxId: 6185]}
mggteeeyynvekligqaedleheyyktlmkpeeekqkiikeilngkvpvlldiiceslk
astgklavgdkvtladlvliavidhvtdldkefltgkypeihkhrenllassprlakyls
dra

SCOPe Domain Coordinates for d1oe7b1:

Click to download the PDB-style file with coordinates for d1oe7b1.
(The format of our PDB-style files is described here.)

Timeline for d1oe7b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1oe7b2