SCOPe 2.01: Domain d1od5b1: 1od5 B:7-251

Lineage for d1od5b1 (1od5 B:7-251)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.2: Germin/Seed storage 7S protein [51187] (5 proteins)

6. Protein Seed storage 7S protein [51188] (6 species)
   duplication: consists of two germin-like domains spatially arranged as subunits in the RmlC dimer; trimer is similar to the germin hexamer

7. Species Soybean (Glycine max), glycinin A3B4 [TaxId:3847] [89412] (1 PDB entry)

8. Domain d1od5b1: 1od5 B:7-251 [86834]
   complexed with co3, mg

Details for d1od5b1

PDB Entry: 1od5, 2.1 Å

PDB Description: crystal structure of glycinin a3b4 subunit homohexamer

PDB Compounds: (B:) glycinin

SCOPe Domain Sequences for d1od5b1:

Sequence, based on SEQRES records:

>d1od5b1 b.82.1.2 (B:7-251) Seed storage 7S protein {Soybean (Glycine max), glycinin A3B4 [TaxId: 3847]}
necqlnnlnalepdhrvesegglietwnsqhpelqcagvtvskrtlnrnglhlpsyspyp
qmiivvqgkgaigfafpgcpetfekpqqqssrrgsrsqqqlqdshqkirhfnegdvlvip
pgvpywtyntgdepvvaislldtsnfnnqldqnprvfylagnpdiehpetmqqqqqqksh
ggrkqgqhqqqeeeggsvlsgfskhflaqsfntnedtaeklrspdderkqivtvegglsv
ispkw

Sequence, based on observed residues (ATOM records):

>d1od5b1 b.82.1.2 (B:7-251) Seed storage 7S protein {Soybean (Glycine max), glycinin A3B4 [TaxId: 3847]}
necqlnnlnalepdhrvesegglietwnsqhpelqcagvtvskrtlnrnglhlpsyspyp
qmiivvqgkgaigfafpgcpetfekpqdshqkirhfnegdvlvippgvpywtyntgdepv
vaislldtsnfnnqldqnprvfylagnpdiehpetmqeggsvlsgfskhflaqsfntned
taeklrspdderkqivtvegglsvispkw

Timeline for d1od5b1:

• d1od5b1 first appeared in SCOP 1.65
  
• d1od5b1 appears in SCOP 1.75
  
• d1od5b1 appears in SCOPe 2.02
  
• d1od5b1 appears in the current release, SCOPe 2.08