SCOP 1.71: Domain d1obbb1: 1obb B:4-172

Lineage for d1obbb1 (1obb B:4-172)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families)

5. Family c.2.1.5: LDH N-terminal domain-like [51848] (8 proteins)

6. Protein Alpha-glucosidase AglA [89530] (1 species)

7. Species Thermotoga maritima [TaxId:243274] [89531] (1 PDB entry)
   TM1834

8. Domain d1obbb1: 1obb B:4-172 [86762]
   Other proteins in same PDB: d1obba2, d1obbb2
   complexed with csw, mal, nad

Details for d1obbb1

PDB Entry: 1obb, 1.9 Å

PDB Description: alpha-glucosidase a, agla, from thermotoga maritima in complex with maltose and nad+

SCOP Domain Sequences for d1obbb1:

Sequence; same for both SEQRES and ATOM records:

>d1obbb1 c.2.1.5 (B:4-172) Alpha-glucosidase AglA {Thermotoga maritima}
vkigiigagsavfslrlvsdlcktpglsgstvtlmdideerldailtiakkyveevgadl
kfektmnlddviidadfvintamvgghtylekvrqigekygyyrgidaqefnmvsdyytf
snynqlkyfvdiarkieklspkawylqaanpifegttlvtrtvpikavg

Timeline for d1obbb1:

• d1obbb1 first appeared in SCOP 1.65
  
• d1obbb1 appears in SCOP 1.69
  
• d1obbb1 appears in SCOP 1.73
  
• d1obbb1 appears in the current release, SCOPe 2.08