Lineage for d1obbb1 (1obb B:4-172)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 307887Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 307888Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families) (S)
  5. 308869Family c.2.1.5: LDH N-terminal domain-like [51848] (5 proteins)
  6. 308870Protein Alpha-glucosidase AglA [89530] (1 species)
  7. 308871Species Thermotoga maritima [TaxId:243274] [89531] (1 PDB entry)
  8. 308873Domain d1obbb1: 1obb B:4-172 [86762]
    Other proteins in same PDB: d1obba2, d1obbb2
    complexed with csw, mal, nad

Details for d1obbb1

PDB Entry: 1obb (more details), 1.9 Å

PDB Description: alpha-glucosidase a, agla, from thermotoga maritima in complex with maltose and nad+

SCOP Domain Sequences for d1obbb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1obbb1 c.2.1.5 (B:4-172) Alpha-glucosidase AglA {Thermotoga maritima}
vkigiigagsavfslrlvsdlcktpglsgstvtlmdideerldailtiakkyveevgadl
kfektmnlddviidadfvintamvgghtylekvrqigekygyyrgidaqefnmvsdyytf
snynqlkyfvdiarkieklspkawylqaanpifegttlvtrtvpikavg

SCOP Domain Coordinates for d1obbb1:

Click to download the PDB-style file with coordinates for d1obbb1.
(The format of our PDB-style files is described here.)

Timeline for d1obbb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1obbb2